PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G000300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family SRS
Protein Properties Length: 398aa    MW: 40940.1 Da    PI: 8.5071
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G000300.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702212.51e-651773383154
                DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkl 91 
                           s t++CqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaa+rrerq +++a     a   ++ ++   ++ +  +++++s+t++
  HL.SW.v1.0.G000300.1 177 SSTTTCQDCGNQAKKDCTHRRCRTCCKSRGFECSTHVKSTWVPAARRRERQLMTTAGPGGGAGPGSSGSTSGAKKPRLITSQTTSHTST 265
                           57889*********************************************999988776666555444444444444557778889999 PP

                DUF702  92 ssaeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           s+++++++++tss          lP +v+++avf+cvrv++v+dge+e+aYq++v+igGhvfkG+LydqG+e+
  HL.SW.v1.0.G000300.1 266 SNTTPPRSFDTSSshqdasfketLPGQVRARAVFKCVRVTAVEDGEDEYAYQAVVKIGGHVFKGFLYDQGVET 338
                           99*******999999*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.9E-62179337IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.2E-27181223IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.5E-29289336IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MWSGPSSRSI NYGLPPEMGM VGLRDVFVVA PASSFHHNNH HHHHHHNLNH DPNLIPDHSL  60
NGSNPATALG VGVGVGVIPL LTAAPCLGPS QLDEAASAAE ANALGSSAAA RSRSGGIQLW  120
QSQNQQAAAI SATQPQLHPH FFKKPSILDH GNSGIGGNFV NQGGGGAGIV GSGSTSSSTT  180
TCQDCGNQAK KDCTHRRCRT CCKSRGFECS THVKSTWVPA ARRRERQLMT TAGPGGGAGP  240
GSSGSTSGAK KPRLITSQTT SHTSTSNTTP PRSFDTSSSH QDASFKETLP GQVRARAVFK  300
CVRVTAVEDG EDEYAYQAVV KIGGHVFKGF LYDQGVETRD SFPNLSELHL GGGGGGGVGG  360
GRNGASTSSS PMLDPSDVYA ATTAGLLGGS TYGNPIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651514.11e-144PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
SwissprotQ94CK99e-81LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA5BRG11e-145A5BRG1_VITVI; Putative uncharacterized protein (Fragment)
STRINGVIT_06s0009g03450.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.29e-71Lateral root primordium (LRP) protein-related